Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceAITCGTVTSSLAPCATYLSSGGEVPPPCCAGVKKLNGMAQTTADRQQACKCLKAAAQ---GINPSLASSLPGKCSVSIPYPISMSTNCDNVK
1SIY Chain:A ((1-91))-MTCGQVQGNLAQCIGFLQKGGVVPPSCCTGVKNILNSSRTTADRRAVCSCLKAAAGAVRGINPNNAEALPGKCGVNIPYKISTSTNCNSIN


General information:
TITO was launched using:
RESULT:

Template: 1SIY.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -55474 for 666 contacts (-83.3/contact) +
2D Compatibility (PS) -9143 + (NN) -4054 + (LL) 144
1D Compatibility (HY) -8400 + (ID) 2500
Total energy: -79427.0 ( -119.26 by residue)
QMean score : 0.518

(partial model without unconserved sides chains):
PDB file : Tito_1SIY.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1SIY-query.scw
PDB file : Tito_Scwrl_1SIY.pdb: