Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGGLQTTGYAENASFSQL----SACFSSRLVREDL-------FLMFSAYN-----QFTLLHSR--------LTMISYNGDDQ---- 1UGI Chain:A ((2-84)) ---TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML

General information: TITO was launched using: RESULT: Template: 1UGI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 175 -30763 -175.79 -559.33 target 2D structure prediction score : 0.35 Monomeric hydrophicity matching model chain A : 0.71 3D Compatibility (PKB) : -175.79 2D Compatibility (Sec. Struct. Predict.) : 0.35 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.122

(partial model without unconserved sides chains): PDB file : Tito_1UGI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1UGI-query.scw PDB file : Tito_Scwrl_1UGI.pdb: