Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MADVLRRAINQKKQFLKTKL--LLSEFYQGRG-EQLADYTLSELEKEYKSLQKMKKEI 2QK1 Chain:A ((313-559)) SHMASMLPEETILDKLPKDFQERITSSKWKDRVEALEEFWDSVLSQTKKLKSTSQNYSNLLGIYGHIIQKDANIQAVALAAQSVELICDKLKTPGFSKDYVSLVFTPLLDRTKEKKPSVIEAIRKALLTICKYYDPLASSGRNEDMLKDILEHMKHKTPQIRMECTQLFNASMKEEKDGYSTLQRYLKDEVVPIVIQIVNDTQPAIRTIGFESFAILIKIFGMNTFVKTLEHLDNLKRKKIEETVKT-

General information: TITO was launched using: RESULT: Template: 2QK1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 137 -18188 -132.76 -336.81 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -132.76 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.443

(partial model without unconserved sides chains): PDB file : Tito_2QK1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2QK1-query.scw PDB file : Tito_Scwrl_2QK1.pdb: