Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNNERLMLKGIFLGAAAGAALSLLHKPTRQACGMRWLTCKHKLSLYKSNPELLKNTVITKVDEAKKLARTLSKEVDFVNQQVKELKKTTPQVMELVQETKEHFSKK 3IH4 Chain:A ((166-196)) ------------------------------------------LRTYQGKPELLKRDMNTLVEEVKVMLRILKK---------------------------------

General information: TITO was launched using: RESULT: Template: 3IH4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 17 -1338 -78.68 -43.15 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -78.68 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.822

(partial model without unconserved sides chains): PDB file : Tito_3IH4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3IH4-query.scw PDB file : Tito_Scwrl_3IH4.pdb: