Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MENQEVVLSIDAIQEPEQIKFNMSLKNQSERAIEFQFSTGQKFELVVYDSEHKERYRYSKEKMFTQAFQNLTLESGETYDFSDVWKEVPE-PGTYEVKVTFKGRAENLKQVQAVQQFEVK 2L0D Chain:A ((16-87)) -------------VPNTVNTMTATIENQGNKDST-------SFNVSLLV-DGIVV-D-------TQTV--TSLESENSTNVDFHWTL-DGTANSYTLTVNVDPE----------------

General information: TITO was launched using: RESULT: Template: 2L0D.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 261 -13947 -53.44 -196.44 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -53.44 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.477

(partial model without unconserved sides chains): PDB file : Tito_2L0D.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2L0D-query.scw PDB file : Tito_Scwrl_2L0D.pdb: