Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEKKFLDAIQQLTKELEMLKKDIDSIKEATVRIDKDLLEYREEISKVKQDDSVLIMQQHKDN 2W83 Chain:C ((40-67)) ---------DELTCEKDVLQGELEAVKQAKLKLEEKN-------------------------

General information: TITO was launched using: RESULT: Template: 2W83.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 1 -80 -80.00 -2.86 target 2D structure prediction score : 0.86 Monomeric hydrophicity matching model chain C : 0.73 3D Compatibility (PKB) : -80.00 2D Compatibility (Sec. Struct. Predict.) : 0.86 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.689

(partial model without unconserved sides chains): PDB file : Tito_2W83.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2W83-query.scw PDB file : Tito_Scwrl_2W83.pdb: