Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSTIKVKSAHKDGQIKLEDLDVVCNKLCKRNNSVLFKLEKYLNKKL-LSDPELTEIRDTILTVSGELSRLRDNLVTDGDSNEGLQ 2O4T Chain:A ((8-45)) ------------------------EKLPKDYQIVYKEIQKYLFKVGPVELNEGIGLLSEILG-----------------------

General information: TITO was launched using: RESULT: Template: 2O4T.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 52 -8394 -161.42 -226.86 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -161.42 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.834

(partial model without unconserved sides chains): PDB file : Tito_2O4T.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2O4T-query.scw PDB file : Tito_Scwrl_2O4T.pdb: