Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTNFVHKTVNGLKSLLDEKGAIQLFCSEGDIMEFLVTFSPDKATLNDIQSFEAKHQLSLPEDYQKFITLHNGAKIFEILSDGENIGGGLQLFSLEEIEEELKYEDLFEGINGIPIGYLLEECHLMIDKDKINQGDPNYLYIFESGLEYNPLNLNFEIFLDRYILANGEPFWDWRYYTAENYYRTR 4NN3 Chain:A ((200-259)) -TALQNGVVDGEENPLDTIQRMKFY----EVQKYLVT--SEHGAMEDYVLFNPSYWESLPENYQKII----------------------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4NN3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 89 -5629 -63.25 -93.82 target 2D structure prediction score : 0.23 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : -63.25 2D Compatibility (Sec. Struct. Predict.) : 0.23 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.369

(partial model without unconserved sides chains): PDB file : Tito_4NN3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4NN3-query.scw PDB file : Tito_Scwrl_4NN3.pdb: