Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTKLKMLSMLTVMIASLFIFSSQALAVQYFTVSTSSGAPVNMR-SGPGTNYPIMLS-IPSGSRVPYYCYAYGTTVTGKYGTSNIWDQIQWKDSRGVVNIGYVSDTYVYTGSDGPVGYKCN 3B9K Chain:L ((49-101)) ----------------------------HYTSTLVSGTPSRFSGSGSGRDYTFSISSVESEDIASYYCLQYDTLYTFGAGT---------------------------------------

General information: TITO was launched using: RESULT: Template: 3B9K.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain L - contact count / total energy / energy per contact / energy per residue : 97 -1367 -14.09 -26.80 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain L : 0.57 3D Compatibility (PKB) : -14.09 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.151

(partial model without unconserved sides chains): PDB file : Tito_3B9K.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3B9K-query.scw PDB file : Tito_Scwrl_3B9K.pdb: