Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIIAAYLVLINLCGFWVMGIDKRKA-QQHKWRISEDRLWLIAIVFGALGVWLGMQTFRHKTKHASFKYGVPLLLVIEAILIAIYYSPFDL 2JZ2 Chain:A ((1-66)) MIFP---------GATVRVTNVDDTYYRFEGLVQRVSDGKAAVLFEN-GNWDKLVTFRLSE-----------LEAVKPILEHHHHHH---

General information: TITO was launched using: RESULT: Template: 2JZ2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 214 -12257 -57.27 -188.56 target 2D structure prediction score : 0.22 Monomeric hydrophicity matching model chain A : 0.52 3D Compatibility (PKB) : -57.27 2D Compatibility (Sec. Struct. Predict.) : 0.22 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.101

(partial model without unconserved sides chains): PDB file : Tito_2JZ2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2JZ2-query.scw PDB file : Tito_Scwrl_2JZ2.pdb: