Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYIDITIDLKHYN-GS-VFDLRLSDYHPVKKVIDIAWQAQSVSMPPREGHWIRVVNKDKVFSGECKLSDCGITNGDRLEIL 3A4R Chain:A ((8-77)) --LRLRV---QGKEKHQMLEISLSPDSPLKVLMSHYEEAMGLSG-----HKLSFFFDGTKLSGKELPADLGLESGDLIEV-

General information: TITO was launched using: RESULT: Template: 3A4R.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 258 -5114 -19.82 -75.21 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain A : 0.70 3D Compatibility (PKB) : -19.82 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.502

(partial model without unconserved sides chains): PDB file : Tito_3A4R.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3A4R-query.scw PDB file : Tito_Scwrl_3A4R.pdb: