Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKHQNPSKRLLRLSIKYLLAAAAVVLTYFAVIYILFSLAGTS---YRSAAHVLLFAVVFLVLGLCFEPFERLMIHSFTFFKTGKRL--FILLAGI-VQLLFLWMTAHTTDQLISDIWLSTTEEMIVAAVFLILDKCNSALPS 5C6P Chain:A ((343-428)) --------------------------------SPLASMYNDDPAVLSIASTVLLFAGLFQPADFTQCIASYALRG----YKVTKVPMFIHAAAFWGCGLLPGYLLAYRFDMGIYGFWTALIA--------------------

General information: TITO was launched using: RESULT: Template: 5C6P.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 128 -20765 -162.23 -259.56 target 2D structure prediction score : 0.18 Monomeric hydrophicity matching model chain A : 0.53 3D Compatibility (PKB) : -162.23 2D Compatibility (Sec. Struct. Predict.) : 0.18 1D Compatibility (Hydrophobicity) : 0.53 QMean score : -0.212

(partial model without unconserved sides chains): PDB file : Tito_5C6P.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5C6P-query.scw PDB file : Tito_Scwrl_5C6P.pdb: