Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPNKSKPNRLIAEKSPYLLQHAHNPVDWFPWGEEAFAKAKRENKPVLVSIGYSTTCHWWPGIIKSCGTPLKDNRSHFKR 3D22 Chain:A ((32-73)) ----------------------------KERWDQKLSEASRDGKIVLANFS-ARWCGPSRQIAPYYIELSE--------

General information: TITO was launched using: RESULT: Template: 3D22.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 43 -5021 -116.76 -119.54 target 2D structure prediction score : 0.62 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -116.76 2D Compatibility (Sec. Struct. Predict.) : 0.62 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.438

(partial model without unconserved sides chains): PDB file : Tito_3D22.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3D22-query.scw PDB file : Tito_Scwrl_3D22.pdb: