Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNHIKWLS-------DLKKAGLLALGKGVITLLKRFSLVIVTLMMSIVVVLAAAKESPGDHVISFDEPIILMISIGIVVFLLIPPLVMSFFGNLVVRIISGVYQCFIVFTFLGLIPIGFLIPNGFLTILVSIAGTLVSIASVAVTLCIGKNKKDI 4FN0 Chain:A ((153-217)) --RITWISSLGGEAKDTQEPGIQA---GTVTIISRYSLVPVGRADGVKVTCRVEHES-------FEEPILLPVTLSV------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4FN0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 152 -27602 -181.59 -475.89 target 2D structure prediction score : 0.16 Monomeric hydrophicity matching model chain A : 0.51 3D Compatibility (PKB) : -181.59 2D Compatibility (Sec. Struct. Predict.) : 0.16 1D Compatibility (Hydrophobicity) : 0.51 QMean score : -0.063

(partial model without unconserved sides chains): PDB file : Tito_4FN0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4FN0-query.scw PDB file : Tito_Scwrl_4FN0.pdb: