Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAVPFRRTSKMKKRLRRTHFKLNVPGMTECPSCG-EMKLSHRVCKACGSYNGKDINVKSN 4WF9 Chain:Z ((2-46)) -AVPKRRTSKTRKNKRRTHFKISVPGMTECPNCGREYKLSHRVCKN--------------

General information: TITO was launched using: RESULT: Template: 4WF9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain Z - contact count / total energy / energy per contact / energy per residue : 51 1030 20.20 23.41 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain Z : 0.83 3D Compatibility (PKB) : 20.20 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.83 QMean score : 0.435

(partial model without unconserved sides chains): PDB file : Tito_4WF9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4WF9-query.scw PDB file : Tito_Scwrl_4WF9.pdb: