Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNLLVTGGAGFIGSNFVHHILNKHDDYKVVNLDLLTYAGTMSNLEDIKENPNHVFVEGNICDYDLVKKLVTDHKIDTIVNFAAESHVDRSIINPGIFIETNVQGTLNLL-NVAKELNVAKYLQVSTDEVYGSLGETGYFTEETPIAPNSPYSASKASADLLVRSYFETYGLNVNITRCSNNYGPHHFPEKLIPLMITNGLDGENLPIYGDGKNIRDWLHVSDHCAAIDLVIHNGKSGEVYNVGGHNERTNNEIVHIIVDDLNLSKDKIVYVEDRLGHDLRYAIDPKKIETELGWEPKYTFDTGIKETIEWYVNNEAWWRPLKSRAKLGE
2HUN Chain:A ((4-321))MKLLVTGGMGFIGSNFIRYILEKHPDWEVINIDKLGYGSNPANLKDLEDDPRYTFVKGDVADYELVKELV--RKVDGVVHLAAESHVDRSISSPEIFLHSNVIGTYTLLESIRRENPEVRFVHVSTDEVYGDILK-GSFTENDRLMPSSPYSATKAASDMLVLGWTRTYNLNASITRCTNNYGPYQFPEKLIPKTIIRASLGLKIPIYGT---VRDWLYVEDHVRAIELVLLKGESREIYNISAGEEKTNLEVVKIILRLMGKGEELIELVEDRPGHDLRYSLDSWKITRDLKWRPKYTFDEGIKKTIDWYLKNEWWWKPL--------


General information:
TITO was launched using:
RESULT:

Template: 2HUN.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -160250 for 2718 contacts (-59.0/contact) +
2D Compatibility (PS) -33388 + (NN) -9969 + (LL) 292
1D Compatibility (HY) -34400 + (ID) 8400
Total energy: -246115.0 ( -90.55 by residue)
QMean score : 0.477

(partial model without unconserved sides chains):
PDB file : Tito_2HUN.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2HUN-query.scw
PDB file : Tito_Scwrl_2HUN.pdb: