Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDELDIAFFILPLGIMLLSIVGTCICKNPYLMPMLSLVISLVLTFTIFNQSFLGWAVVYSLVSLALSYITLIVVRKRKESGN 4LLH Chain:A ((149-189)) --------------------------------------VGVAMSTTMFHWTLHPWAI-YAIVGLAIAYSTFRVGRKQ-----

General information: TITO was launched using: RESULT: Template: 4LLH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 23 -2836 -123.28 -74.62 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : -123.28 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.58 QMean score : -0.066

(partial model without unconserved sides chains): PDB file : Tito_4LLH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4LLH-query.scw PDB file : Tito_Scwrl_4LLH.pdb: