Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNLNFIVPDINMTFGDMKFMGLNRERYVYDRENNKRTDVLESRIYNIASAVQGGQIEVTIPEYAGAKEIPPFADIELKNPKISAMATSQRDSTYANVMWKLEADDIVVKGGSSVKPAAATGGNEKK 3W3S Chain:A ((98-134)) ---------------------------------------------------------------------------DLKIPRYEVVLRFDREVTYDYVGYVPVADDVVVEDGT--------------

General information: TITO was launched using: RESULT: Template: 3W3S.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 49 -6228 -127.10 -168.32 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -127.10 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.413

(partial model without unconserved sides chains): PDB file : Tito_3W3S.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3W3S-query.scw PDB file : Tito_Scwrl_3W3S.pdb: