Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MISIMMKVSLAVFMLAGGIIKVSRVPFQVEHWRHYQYPLWFLTVTGILEIAGALAMTAGIWNRYAAIGAGVLFVVLMAGAIHAHMFRARQSVIMAIQAMICLIVSIMIIMGSYT 2MIC Chain:A ((19-33)) --------------------------------------------------------------------------------------------------AVVVGLVAYIAFKRW-

General information: TITO was launched using: RESULT: Template: 2MIC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 4 -870 -217.38 -57.97 target 2D structure prediction score : 0.93 Monomeric hydrophicity matching model chain A : 0.40 3D Compatibility (PKB) : -217.38 2D Compatibility (Sec. Struct. Predict.) : 0.93 1D Compatibility (Hydrophobicity) : 0.40 QMean score : -0.023

(partial model without unconserved sides chains): PDB file : Tito_2MIC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MIC-query.scw PDB file : Tito_Scwrl_2MIC.pdb: