Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSEALTFESKYALLYLGGGLLAMIYGLITFFMAFPAFTSRGNVIFTIKTGPSGEIFLRKRSVLFSEVKRLYMGRHQYSLKGIFFEDIIIEKTDGKIVRIPTWNIITNPLFFEAVERYILPHLNEEAQNNWISQFTEVQRKAYLKEFENHPKL 3P14 Chain:A ((328-382)) --------------------------------------------------------------------------------------------DASINRIAAWTIGTRNVIKALLFAMLIPH---KQLKEWQETGDYTRRLAVLEEFKTYP--

General information: TITO was launched using: RESULT: Template: 3P14.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 65 -3706 -57.01 -67.37 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain A : 0.52 3D Compatibility (PKB) : -57.01 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.117

(partial model without unconserved sides chains): PDB file : Tito_3P14.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3P14-query.scw PDB file : Tito_Scwrl_3P14.pdb: