Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDSMDHRIERLEYYIQLLVKTVDMDRYPFYALLIDKGLSKEEGEAVMRICDELSEELATQKAQGFVTFDKLLALFAGQLNEKLDVHETIFALYEQGLYQELMEVFIDIMKHFD 1YGO Chain:A ((49-98)) ------------------------------------------------------EQISSQKQRGRSASNEFLNIWGGQYNHTV---QTLFALFKKLKLHNAMRLIKD------

General information: TITO was launched using: RESULT: Template: 1YGO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 79 -12878 -163.01 -257.55 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -163.01 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.490

(partial model without unconserved sides chains): PDB file : Tito_1YGO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1YGO-query.scw PDB file : Tito_Scwrl_1YGO.pdb: