Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRLSELSGKEIVDIKRAERLGVLGQTDLEINEQDGQITALLIPTVKWFGLRKQGHDIRVPWHHIQKIGSDMIILDVPEEMPPRQE 1PM3 Chain:A ((3-76)) -IVEEMVGKEVLDS-SAKVIGKV--KDVEVDIESQAIESLVLGKGG--------GETIVPYEMVKKIGDKILLKGPE--------

General information: TITO was launched using: RESULT: Template: 1PM3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 230 -32835 -142.76 -505.15 target 2D structure prediction score : 0.62 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : -142.76 2D Compatibility (Sec. Struct. Predict.) : 0.62 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.593

(partial model without unconserved sides chains): PDB file : Tito_1PM3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1PM3-query.scw PDB file : Tito_Scwrl_1PM3.pdb: