Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIREHLLKEIEKKRAELLQIVMANGMTSHITIELSQELDHLLIQYQKQRLRAVAGDE 3V7Q Chain:A ((27-74)) -----VIKEIRNARAKL--VLLTEDASSNTAKKVTDKCNYYKVPYKKVESRAVLG--

General information: TITO was launched using: RESULT: Template: 3V7Q.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 137 -18844 -137.55 -392.58 target 2D structure prediction score : 0.35 Monomeric hydrophicity matching model chain A : 0.81 3D Compatibility (PKB) : -137.55 2D Compatibility (Sec. Struct. Predict.) : 0.35 1D Compatibility (Hydrophobicity) : 0.81 QMean score : 0.571

(partial model without unconserved sides chains): PDB file : Tito_3V7Q.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3V7Q-query.scw PDB file : Tito_Scwrl_3V7Q.pdb: