Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MADRYVLIEVNEDGEGRLKDEAVTWIDFRLSIVDFNASEGLNQLMEQISK--DVKDELVLVLFN----YRVKSSYDSWSGATEYEDFFDVEFFKVIKKNYKKFYQGLVTVELDVGINGFDNIESMPTDSNQNYYRNLIAEWEEFYNEDFIPLSLNKR 3PZG Chain:A ((94-163)) -----------------------------------NAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDE---RIKEEYKKYVSFLI-------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3PZG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 124 2759 22.25 43.10 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : 22.25 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.370

(partial model without unconserved sides chains): PDB file : Tito_3PZG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3PZG-query.scw PDB file : Tito_Scwrl_3PZG.pdb: