Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKAIIKEDVQASLERYADRPVYIHLETTTGSYSAHLNEKNMTVVAYI---RNAKVTYHQAKIKG--NGPYRVGLKTEEGWIYAEGLTEYTVDEENRLLMAGHLPGGKLAISLQISEKPFTV 1YLQ Chain:A ((7-79)) IKEITKKDVQ-------DAEIYLYGSVVEGDYSIGLSDIDVAIVSDVFEDRNRKLEFFGKITKKFFDSPFEFHILTKKEW-----------------------------------------

General information: TITO was launched using: RESULT: Template: 1YLQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 230 2533 11.01 37.24 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : 11.01 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.360

(partial model without unconserved sides chains): PDB file : Tito_1YLQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1YLQ-query.scw PDB file : Tito_Scwrl_1YLQ.pdb: