Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNTAYRVWDGEQMHYWDDEGLSLIIKSNGDWTLKRLYTDVLVPVVDSTNRNAALMWGAKVRGKFIYDRSIVKITSDDKESSDVCEVKFSDGVFQVDVSKISADYDVTAVGWVEYATIEVIGDVYQNPELLEGVK 2P84 Chain:A ((117-130)) ---------------------------------------------------------------------------------------------------------------------EVLGNIYENPELLE---

General information: TITO was launched using: RESULT: Template: 2P84.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 10 -842 -84.20 -60.14 target 2D structure prediction score : 0.21 Monomeric hydrophicity matching model chain A : 0.53 3D Compatibility (PKB) : -84.20 2D Compatibility (Sec. Struct. Predict.) : 0.21 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 1.158

(partial model without unconserved sides chains): PDB file : Tito_2P84.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2P84-query.scw PDB file : Tito_Scwrl_2P84.pdb: