Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAKYTIVDKDTCIACGACGAAAPDIYDYDDEGIAFVTLDENKGVVEVPEVLEEDMIDAFEGCPTDSIKVADEPFEGDPLKFE 1IR0 Chain:A ((2-81)) --KYTIVDKETCIACGACGAAAPDIYDYDEDGIAYVTLDDNQGIVEVPDILIDDMMDAFEGCPTDSIKVADEPFDGDPNKFE

General information: TITO was launched using: RESULT: Template: 1IR0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 384 -45610 -118.77 -570.12 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain A : 0.96 3D Compatibility (PKB) : -118.77 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.96 QMean score : 0.655

(partial model without unconserved sides chains): PDB file : Tito_1IR0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1IR0-query.scw PDB file : Tito_Scwrl_1IR0.pdb: