Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL 1I2W Chain:A ((116-149)) ----LRYSDNTAQN--------------LILKQIGGPESLKKELRKIGDEVT---------------------------

General information: TITO was launched using: RESULT: Template: 1I2W.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 35 685 19.56 20.13 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : 19.56 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.121

(partial model without unconserved sides chains): PDB file : Tito_1I2W.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1I2W-query.scw PDB file : Tito_Scwrl_1I2W.pdb: