Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTMFVESINDVLFLVDFFTIILPALTAIGIAFLL-RECRAGEQWKSKRTDEHQTVFHINRTDFLIIIYHRITTWIRKVFRMNSPVNDEEDAGSLLL 2MKV Chain:A ((33-62)) ----------------------GLAFIVGLLILLSRRFRSGGNKKRRQINED--------------------------------------------

General information: TITO was launched using: RESULT: Template: 2MKV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 14 2356 168.25 81.22 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain A : 0.52 3D Compatibility (PKB) : 168.25 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.355

(partial model without unconserved sides chains): PDB file : Tito_2MKV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MKV-query.scw PDB file : Tito_Scwrl_2MKV.pdb: