Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNEKGFTLVEMLIVLFIISILLLITIPNVTKHNQTIQKKGCEGLQNMVKAQMTAFELDHEGQTPSLADLQSEGYVKKDAVCPNGKRIIITGGEVKVEH 4O8M Chain:A ((265-310)) ----------------------------VTYGGGLIEQAENEALENLKKAGVTVNDVDLPAFEASVADVISTGF------------------------

General information: TITO was launched using: RESULT: Template: 4O8M.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 24 -1327 -55.27 -28.84 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -55.27 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.388

(partial model without unconserved sides chains): PDB file : Tito_4O8M.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4O8M-query.scw PDB file : Tito_Scwrl_4O8M.pdb: