Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVENPMVINNWHDKLTETDVQIDFYGDEVTPVDDYVIDGG-EIILRENLERYLR--EQLGFEFKNAQ 3C6Q Chain:B ((274-304)) ---------------------------------DYVIDTGVDVVTPENLDEYLKKMEELGIPIK---

General information: TITO was launched using: RESULT: Template: 3C6Q.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 17 -2830 -166.44 -101.05 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain B : 0.70 3D Compatibility (PKB) : -166.44 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.636

(partial model without unconserved sides chains): PDB file : Tito_3C6Q.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3C6Q-query.scw PDB file : Tito_Scwrl_3C6Q.pdb: