Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGMPVEFNTLIVTKGKEVRI-DENIFTLEKDG---YRVYPMEIPMDVRKTKFGEKSGTAEVQKLQWEEGRTIITYKLTSLHSVN 2BNE Chain:A ((195-237)) ---------------KELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGT--------------------------

General information: TITO was launched using: RESULT: Template: 2BNE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 45 5291 117.57 135.65 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : 117.57 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.241

(partial model without unconserved sides chains): PDB file : Tito_2BNE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2BNE-query.scw PDB file : Tito_Scwrl_2BNE.pdb: