Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKSKLSILMIGFALSVLLAACGSNDAKEEKTDTGSKTEATASEGEELYQQSCVGCHGKDLEGVSGPNLQEVGGKYDEHKIESIIKNGRGNMPKGLVDDNEAAVIAKWLSEKK 1K3H Chain:A ((2-71)) ------------------------------------------DAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

General information: TITO was launched using: RESULT: Template: 1K3H.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 286 -27447 -95.97 -392.10 target 2D structure prediction score : 0.84 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : -95.97 2D Compatibility (Sec. Struct. Predict.) : 0.84 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.490

(partial model without unconserved sides chains): PDB file : Tito_1K3H.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1K3H-query.scw PDB file : Tito_Scwrl_1K3H.pdb: