Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -------------------------------MKCNKMNRVQLKEGSVSMTL---------------------------------- 4IL7 Chain:A ((138-222)) ENYLIYSGFGTSLPQTYTIPANGYLIISITNTSTGNIGQITLTIGSTTMTFNLQTGENKIPVIAGTQITNMTLTSSSAILIYEEV

General information: TITO was launched using: RESULT: Template: 4IL7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 13 767 59.00 38.35 target 2D structure prediction score : 0.85 Monomeric hydrophicity matching model chain A : 0.50 3D Compatibility (PKB) : 59.00 2D Compatibility (Sec. Struct. Predict.) : 0.85 1D Compatibility (Hydrophobicity) : 0.50 QMean score : 0.797

(partial model without unconserved sides chains): PDB file : Tito_4IL7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4IL7-query.scw PDB file : Tito_Scwrl_4IL7.pdb: