Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMIFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAAS
4MFR Chain:A ((2-162))-IFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALA-----AKAETILDEVLAAAA


General information:
TITO was launched using:
RESULT:

Template: 4MFR.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -45127 for 1000 contacts (-45.1/contact) +
2D Compatibility (PS) -17195 + (NN) -5754 + (LL) 184
1D Compatibility (HY) -20000 + (ID) 7750
Total energy: -95642.0 ( -95.64 by residue)
QMean score : 0.487

(partial model without unconserved sides chains):
PDB file : Tito_4MFR.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4MFR-query.scw
PDB file : Tito_Scwrl_4MFR.pdb: