Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMKFPVYIHSISGNSVFNNGFAVSISPFSVSKTTEGSGGSNTGLVFESNALSQTSSANQAQNVTYAIQELLSKLLA 4MQV Chain:B ((5-30)) --------------------------------------------------LTEEQRKKIEENRQKALARRAEKLLA

General information: TITO was launched using: RESULT: Template: 4MQV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 7 -409 -58.43 -15.73 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain B : 0.51 3D Compatibility (PKB) : -58.43 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.51 QMean score : 0.608

(partial model without unconserved sides chains): PDB file : Tito_4MQV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4MQV-query.scw PDB file : Tito_Scwrl_4MQV.pdb: