Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPYQINIANIKINGVTQNGNIDVGPTVHNSHTANSKYFGANFSLGDLSPTSSLLNTGNIDSDVSDQDQIGNPSAPISNQI 4PBZ Chain:B ((1-22)) ---------------------------------------------------------KLLSSSETKRAARRPYKPIALR-

General information: TITO was launched using: RESULT: Template: 4PBZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 28 1516 54.14 68.91 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain B : 0.55 3D Compatibility (PKB) : 54.14 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.434

(partial model without unconserved sides chains): PDB file : Tito_4PBZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4PBZ-query.scw PDB file : Tito_Scwrl_4PBZ.pdb: