Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKP-NISLINAVFRIACGLTIMSAASAKFTKKPWCRMHLFYIFMGAMKAGSGILRFCPVTYMFQHSDSGNNEHQNG 2AYJ Chain:A ((1-56)) MPLTDPAKLQIVQQRVFLKKVCRKCGALNPIRA----------TKCRRCHSTNLRL----------KKKELPTKKG

General information: TITO was launched using: RESULT: Template: 2AYJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 148 -2266 -15.31 -41.19 target 2D structure prediction score : 0.47 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : -15.31 2D Compatibility (Sec. Struct. Predict.) : 0.47 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.032

(partial model without unconserved sides chains): PDB file : Tito_2AYJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2AYJ-query.scw PDB file : Tito_Scwrl_2AYJ.pdb: