Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSRISIEEVKHVAHLARLAITEEEAKMFTEQLDSIISFAEELNEVNTDNVEPTTHVLKMKNVMREDEAGKGLPVEDVMKNAPDHKDGYIRVPSILD 3UDB Chain:A ((112-191)) -------------------FSEDEARFFFQQLISGVSYAHAMQVAHRD--------LKLENTLLDGSPAPRLKIAD--------------------

General information: TITO was launched using: RESULT: Template: 3UDB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 91 -12693 -139.48 -259.03 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : -139.48 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.563

(partial model without unconserved sides chains): PDB file : Tito_3UDB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3UDB-query.scw PDB file : Tito_Scwrl_3UDB.pdb: