Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSVFLIVLSCITLAFASGAVYYIKLLSQAASYPPKRVIRQKALVCSTGTAFTLCLIFFTKLLA-------------------------- 1YA5 Chain:T ((1-89)) MATSELSSEVSEENSERREAFWAEWKDLTLSTRPEEGSSLHEEDTQRHETYHQQGQSQVLVQRSPWLMMRMGILGRGLQEYQLPYQRVL

General information: TITO was launched using: RESULT: Template: 1YA5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain T - contact count / total energy / energy per contact / energy per residue : 146 -7057 -48.33 -112.01 target 2D structure prediction score : 0.21 Monomeric hydrophicity matching model chain T : 0.49 3D Compatibility (PKB) : -48.33 2D Compatibility (Sec. Struct. Predict.) : 0.21 1D Compatibility (Hydrophobicity) : 0.49 QMean score : 0.009

(partial model without unconserved sides chains): PDB file : Tito_1YA5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1YA5-query.scw PDB file : Tito_Scwrl_1YA5.pdb: