Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------------------------------------------------------------------------------------------------MNEFEKWIEGRYEPHEQKQKEHEDTMGSIRKDLDAFDKAGLEFEDEIEELAEKTEALLKKHQAQYDQS- 3VJZ Chain:A ((0-163)) HMTALTLPEDIRQQEPSALLYTLVSAYLEHTAQTGDESLSCLSDDQHTLTAFCYLDSQVEEGGFVQLIASGYGEYIFRNPLADSLRRWKIKAVPKVLDKAKALYEQHGKTIETLADGGAD-IPSLRKQFPEFEEWDGAYYEAAEQDLPLLAEHIQSNWETFAHIG

General information: TITO was launched using: RESULT: Template: 3VJZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 89 -8502 -95.52 -126.89 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : -95.52 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.537

(partial model without unconserved sides chains): PDB file : Tito_3VJZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3VJZ-query.scw PDB file : Tito_Scwrl_3VJZ.pdb: