Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------MEPYQRYEELKKKTIKVVQKENYSIRYITQDEASNDLDEFYKQFAQHLLEAALERKAE------------- 3LVG Chain:D ((-103)) QADRLTQEPESIRKWREEQRKRLQELDAASKVMEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADII

General information: TITO was launched using: RESULT: Template: 3LVG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 49 7744 158.03 133.51 target 2D structure prediction score : 0.33 Monomeric hydrophicity matching model chain D : 0.73 3D Compatibility (PKB) : 158.03 2D Compatibility (Sec. Struct. Predict.) : 0.33 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.148

(partial model without unconserved sides chains): PDB file : Tito_3LVG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3LVG-query.scw PDB file : Tito_Scwrl_3LVG.pdb: