Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -MLGRTKLGNRNAQANNNAKKKNGFQTHFDSYAGREAEKLIASNKRHND 1SSZ Chain:A ((1-34)) CWLCRALIKRIQAMIPK---------------GGRMLPQLVCRLVLRCS

General information: TITO was launched using: RESULT: Template: 1SSZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 67 2792 41.67 84.61 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : 41.67 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.320

(partial model without unconserved sides chains): PDB file : Tito_1SSZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1SSZ-query.scw PDB file : Tito_Scwrl_1SSZ.pdb: