Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
4FN9 Chain:A ((6-253))----PSLISILQAIEPEVVYAGYDNTQPDTTNYLLSSLNRLAEKQLVSVVKWAKALPGFRNLHLDDQMTLIQYSWMGLMAFAMGWRSYKHTNGQMLYFAPDLIFNEQRMQQSAMYDLCQGMQQISQEFVRLQVTQEEFLCMKALLLLSTVPKEGLKSQASFDEMRMNYIKELNRAIAKKENNSAQNWQRFYQLTKLLDSMHDLVGGLLQFCFYTFVQSQALSVEFPEMLVEIISAQLPKVLAGMAKPLLFHK-


General information:
TITO was launched using:
RESULT:

Template: 4FN9.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -170526 for 1951 contacts (-87.4/contact) +
2D Compatibility (PS) -26604 + (NN) -14792 + (LL) 768
1D Compatibility (HY) -32800 + (ID) 8400
Total energy: -252354.0 ( -129.35 by residue)
QMean score : 0.726

(partial model without unconserved sides chains):
PDB file : Tito_4FN9.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4FN9-query.scw
PDB file : Tito_Scwrl_4FN9.pdb: