Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMPKERRSRRRPQPIIRWVSLTLTLLALCQPIQTWRCSLSLGNQQWM---------------TTYNQEAKFFIS-------------IDQILEAHNQSPFCPRSPRYTLDFVNGYP--KIYWPPPQGRRRFGARAMVTY--------------DCEPRCPYVGADHFDCPHWDNASQADQGS------------FYVN-----HQTLFLHLKQCHGIFTLTWEIWGYDPLITFSLHKIPDPPQ-------------
2VVE Chain:A ((3-254))QEQTTKSRDVNSFQIPLRDGVRELLP--EDASRNRASIKSPVDIWIGGENMTALNGIVDGGRKFEAGQEFQINTFGSVNYWVSDEEIRVFKEYSARAKYAQNEGRTALEA-NNVPFFDIDVPPELDGVPFSLKARVRHKSKGVDGLGDYTSISVKPAFYITEGDETTDTLIKYTSYGSTGSHSGYDFDDNTLDVMVTLSAGVHRVFPVETELDYDAVQEVQHDWYDESFTTFIEVYSDDPLLTVKGYAQILMERT


General information:
TITO was launched using:
RESULT:

Template: 2VVE.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -58124 for 1106 contacts (-52.6/contact) +
2D Compatibility (PS) -18375 + (NN) 1328 + (LL) 424
1D Compatibility (HY) -400 + (ID) 1700
Total energy: -76847.0 ( -69.48 by residue)
QMean score : ?

(partial model without unconserved sides chains):
PDB file : Tito_2VVE.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2VVE-query.scw
PDB file : Tito_Scwrl_2VVE.pdb: