Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)


Input alignment information:
Query sequenceMLVCMCFKVLKTLKIGCTEKPHLLKL-----------------------------------------
4O66 Chain:A ((10-76))FLRGACIKTGDRFRVKIGYNQELIAVFKSLPSRHYDSFTKTWDFSMSDYRALMKAVERLSTVSLKPL


General information:
TITO was launched using:
RESULT:

Template: 4O66.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output 		3D Compatibility (PKB) -4046 for 98 contacts (-41.3/contact) +
2D Compatibility (PS) -2800 + (NN) 1611 + (LL) 0
1D Compatibility (HY) -2000 + (ID) 200
Total energy: -7435.0 ( -75.87 by residue)
QMean score : 0.245

(partial model without unconserved sides chains):
PDB file : Tito_4O66.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4O66-query.scw
PDB file : Tito_Scwrl_4O66.pdb: