Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------------------------------------------------------------MRRAHAKKPLTTKSCKVKEGYMRRAHAKKPLTTKSCKVKEG-----YMHRAQAKKPLTTKGCKEEEGYMHRAHA----------
1T6S Chain:A ((1-162))MQEQRQQLLRSLEALIFSSEEPVNLQTLSQITAHKFTPSELQEAVDELNRDYEATGRTFRIHAIAGGYRFLTEPEFADLVRQLLAPVIQRRLSRSMLEVLAVVAWHQPVTKGEIQQIRGASPDYSIDRLLARGLIEVRGRADSPGRPLQYGTTEVFLDLFHL


General information:
TITO was launched using:
RESULT:

Template: 1T6S.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) 27197 for 411 contacts (66.2/contact) +
2D Compatibility (PS) -7245 + (NN) -4594 + (LL) 0
1D Compatibility (HY) -400 + (ID) 400
Total energy: 14558.0 ( 35.42 by residue)
QMean score : 0.270

(partial model without unconserved sides chains):
PDB file : Tito_1T6S.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1T6S-query.scw
PDB file : Tito_Scwrl_1T6S.pdb: