Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMIRIGQGYDVHKLAYDRDLIIGGVKIPYEKGLLGHSDADVLLHAITDAIIGAIGAGDIGHFFPDTDMVFKDADSAELLAEIWQKVEADGFRLGNLDATIIAEKPKMAPYVEQMKLRIAELLHADSAQVNVKATTTEKLGFTGREEGIASLAVVLLEK
3ESJ Chain:A ((7-162))-MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK


General information:
TITO was launched using:
RESULT:

Template: 3ESJ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -112249 for 1318 contacts (-85.2/contact) +
2D Compatibility (PS) -17197 + (NN) -10057 + (LL) 208
1D Compatibility (HY) -14000 + (ID) 4850
Total energy: -158145.0 ( -119.99 by residue)
QMean score : 0.598

(partial model without unconserved sides chains):
PDB file : Tito_3ESJ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3ESJ-query.scw
PDB file : Tito_Scwrl_3ESJ.pdb: