Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------------------------------------------------MSAIAKFFRNVSSEMHKVTWPTRKELLTYTVTVVITVVLFALFFMLIDFG----------IEQIIKLIV----------
1TM9 Chain:A ((1-137))MEQNNIKEQLISFFNQACSTHQERLDFICSTRESDTFSSVDVPLEPIKNIIEITKDENQQIEITKIAVNNIKTLSSV-GATGQYMASFFSTNSEPAIIFCVIYFLYHFGFLKDNNKKQIIKKAYETIADNIADYLNEN


General information:
TITO was launched using:
RESULT:

Template: 1TM9.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -53105 for 334 contacts (-159.0/contact) +
2D Compatibility (PS) -6011 + (NN) -3560 + (LL) 52
1D Compatibility (HY) -2400 + (ID) 600
Total energy: -65624.0 ( -196.48 by residue)
QMean score : 0.714

(partial model without unconserved sides chains):
PDB file : Tito_1TM9.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1TM9-query.scw
PDB file : Tito_Scwrl_1TM9.pdb: