Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------MADVLRRAINQKKQFLKTKLLLSEFYQGRGEQLADYTLSELEKEYKSLQKMKKEI-----
1Z56 Chain:A ((159-235))ADKLYKDICCVNDSYRNIKESDSSNRNRVEQLARERELLDKLLETRDERTRAMMVTLLNEKKKKIRELHEILRQNNI


General information:
TITO was launched using:
RESULT:

Template: 1Z56.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 25 2898 115.90 52.68
target 2D structure prediction score : 0.73
Monomeric hydrophicity matching model chain A : 0.71

3D Compatibility (PKB) : 115.90
2D Compatibility (Sec. Struct. Predict.) : 0.73
1D Compatibility (Hydrophobicity) : 0.71
QMean score : 0.363

(partial model without unconserved sides chains):
PDB file : Tito_1Z56.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1Z56-query.scw
PDB file : Tito_Scwrl_1Z56.pdb: